TRADD Blocking Peptide (33R-10088)

A synthetic peptide for use as a blocking control in assays to test for specificity of TRADD antibody, catalog no. 70R-10446

Synonyms TRADD control peptide, TRADD antibody Blocking Peptide, Anti-TRADD Blocking Peptide, TNFRSF1A-associated via death domain Blocking Peptide, Hs.89862 Blocking Peptide, MGC11078 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL
Molecular Weight 34 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRADD is the adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B.The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors