TRADD Blocking Peptide (33R-10088)
A synthetic peptide for use as a blocking control in assays to test for specificity of TRADD antibody, catalog no. 70R-10446
Overview
Overview
| Synonyms | TRADD control peptide, TRADD antibody Blocking Peptide, Anti-TRADD Blocking Peptide, TNFRSF1A-associated via death domain Blocking Peptide, Hs.89862 Blocking Peptide, MGC11078 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL |
|---|---|
| Molecular Weight | 34 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TRADD is the adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B.The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product