Transglutaminase 5 Blocking Peptide (33R-9671)

A synthetic peptide for use as a blocking control in assays to test for specificity of TGM5 antibody, catalog no. 70R-2264

Synonyms Transglutaminase 5 control peptide, Transglutaminase 5 antibody Blocking Peptide, Anti-Transglutaminase 5 Blocking Peptide, TGM5 Blocking Peptide, MGC141907 Blocking Peptide, TGM6 Blocking Peptide, TGMX Blocking Peptide, TGX Blocking Peptide, Transglutaminase 5, Transglutaminase -5, Transglutaminase 5, Transglutaminase -5 Blocking Peptide, Transglutaminase 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Molecular Weight 81 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors