Transglutaminase 5 Blocking Peptide (33R-9671)
A synthetic peptide for use as a blocking control in assays to test for specificity of TGM5 antibody, catalog no. 70R-2264
Overview
Overview
| Synonyms | Transglutaminase 5 control peptide, Transglutaminase 5 antibody Blocking Peptide, Anti-Transglutaminase 5 Blocking Peptide, TGM5 Blocking Peptide, MGC141907 Blocking Peptide, TGM6 Blocking Peptide, TGMX Blocking Peptide, TGX Blocking Peptide, Transglutaminase 5, Transglutaminase -5, Transglutaminase 5, Transglutaminase -5 Blocking Peptide, Transglutaminase 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL |
|---|---|
| Molecular Weight | 81 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product