Transportin 2 antibody (70R-2016)

Rabbit polyclonal Transportin 2 antibody

Synonyms Polyclonal Transportin 2 antibody, Anti-Transportin 2 antibody, KPNB2B antibody, IPO3 antibody, FLJ12155 antibody, Importin 3 Karyopherin Beta 2B antibody, Transportin -2, TRN2 antibody, Transportin 2, Transportin 2, Transportin -2 antibody, Transportin 2 antibody, TNPO2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA
Assay Information Transportin 2 Blocking Peptide, catalog no. 33R-5534, is also available for use as a blocking control in assays to test for specificity of this Transportin 2 antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 100 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNPO2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors