TRAPPC4 antibody (70R-5260)

Rabbit polyclonal TRAPPC4 antibody raised against the middle region of TRAPPC4

Synonyms Polyclonal TRAPPC4 antibody, Anti-TRAPPC4 antibody, TRAPPC-4, Trafficking Protein Particle Complex 4 antibody, TRS23 antibody, TRAPPC4, HSPC172 antibody, PTD009 antibody, CGI-104 antibody, TRAPPC 4 antibody, TRAPPC-4 antibody, SBDN antibody, TRAPPC 4
Specificity TRAPPC4 antibody was raised against the middle region of TRAPPC4
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TRAPPC4 antibody was raised using the middle region of TRAPPC4 corresponding to a region with amino acids EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV
Assay Information TRAPPC4 Blocking Peptide, catalog no. 33R-2512, is also available for use as a blocking control in assays to test for specificity of this TRAPPC4 antibody


Western Blot analysis using TRAPPC4 antibody (70R-5260)

TRAPPC4 antibody (70R-5260) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAPPC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRAPPC4 antibody (70R-5260) | TRAPPC4 antibody (70R-5260) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors