TRAPPC6B antibody (70R-3155)

Rabbit polyclonal TRAPPC6B antibody raised against the middle region of TRAPPC6B

Synonyms Polyclonal TRAPPC6B antibody, Anti-TRAPPC6B antibody, TRAPPCB-6 antibody, TRAPPCB 6 antibody, TRAPPCB-6, TRAPPC6B, TRAPPCB 6, Trafficking Protein Particle Complex 6B antibody
Specificity TRAPPC6B antibody was raised against the middle region of TRAPPC6B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
Assay Information TRAPPC6B Blocking Peptide, catalog no. 33R-9336, is also available for use as a blocking control in assays to test for specificity of this TRAPPC6B antibody

Images

Western Blot analysis using TRAPPC6B antibody (70R-3155)

TRAPPC6B antibody (70R-3155) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAPPC6B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRAPPC6B antibody (70R-3155) | TRAPPC6B antibody (70R-3155) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors