TRIM34 Blocking Peptide (33R-8637)
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM34 antibody, catalog no. 70R-8052
Overview
Overview
| Synonyms | TRIM34 control peptide, TRIM34 antibody Blocking Peptide, Anti-TRIM34 Blocking Peptide, tripartite motif-containing 34 Blocking Peptide, IFP1 Blocking Peptide, RNF21 Blocking Peptide, TRIM34, TRIM-34, TRIM 34, TRIM-34 Blocking Peptide, TRIM 34 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEVKLSPDNGKKRDLCD |
|---|---|
| Molecular Weight | 31 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TRIM34 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Expression of this gene is up-regulated by interferon. This gene is mappped to chromosome 11p15, where it resides within a TRIM gene cluster. Alternate splicing of this gene generates four transcript variants. Additionally, a read-through transcript transcribed from this gene and TRIM6 has been observed. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product