TRIM34 Blocking Peptide (33R-8637)

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM34 antibody, catalog no. 70R-8052

Synonyms TRIM34 control peptide, TRIM34 antibody Blocking Peptide, Anti-TRIM34 Blocking Peptide, tripartite motif-containing 34 Blocking Peptide, IFP1 Blocking Peptide, RNF21 Blocking Peptide, TRIM34, TRIM-34, TRIM 34, TRIM-34 Blocking Peptide, TRIM 34 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEVKLSPDNGKKRDLCD
Molecular Weight 31 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRIM34 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Expression of this gene is up-regulated by interferon. This gene is mappped to chromosome 11p15, where it resides within a TRIM gene cluster. Alternate splicing of this gene generates four transcript variants. Additionally, a read-through transcript transcribed from this gene and TRIM6 has been observed.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors