TRIM43 Blocking Peptide (33R-6890)

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM43 antibody, catalog no. 70R-2814

Synonyms TRIM43 control peptide, TRIM43 antibody Blocking Peptide, Anti-TRIM43 Blocking Peptide, Tripartite Motif-Containing 43 Blocking Peptide, TRIM43, TRIM-43, TRIM 43, TRIM-43 Blocking Peptide, TRIM 43 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors