TRIM43 Blocking Peptide (33R-6890)
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM43 antibody, catalog no. 70R-2814
Overview
Overview
| Synonyms | TRIM43 control peptide, TRIM43 antibody Blocking Peptide, Anti-TRIM43 Blocking Peptide, Tripartite Motif-Containing 43 Blocking Peptide, TRIM43, TRIM-43, TRIM 43, TRIM-43 Blocking Peptide, TRIM 43 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product