TRIM55 Blocking Peptide (33R-8465)
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM55 antibody, catalog no. 70R-2822
Overview
Overview
| Synonyms | TRIM55 control peptide, TRIM55 antibody Blocking Peptide, Anti-TRIM55 Blocking Peptide, Tripartite Motif-Containing 55 Blocking Peptide, MURF-2 Blocking Peptide, RNF29 Blocking Peptide, TRIM55, TRIM-55, TRIM 55, TRIM-55 Blocking Peptide, TRIM 55 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ |
|---|---|
| Molecular Weight | 27 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product