TRIM55 Blocking Peptide (33R-8465)

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM55 antibody, catalog no. 70R-2822

Synonyms TRIM55 control peptide, TRIM55 antibody Blocking Peptide, Anti-TRIM55 Blocking Peptide, Tripartite Motif-Containing 55 Blocking Peptide, MURF-2 Blocking Peptide, RNF29 Blocking Peptide, TRIM55, TRIM-55, TRIM 55, TRIM-55 Blocking Peptide, TRIM 55 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ
Molecular Weight 27 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors