Tropomodulin 2 antibody (70R-5239)

Rabbit polyclonal Tropomodulin 2 antibody

Synonyms Polyclonal Tropomodulin 2 antibody, Anti-Tropomodulin 2 antibody, MGC39481 antibody, Tropomodulin -2, Tropomodulin 2 antibody, TMOD2 antibody, Tropomodulin 2, Tropomodulin -2 antibody, Tropomodulin 2, NTMOD antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDRED
Assay Information Tropomodulin 2 Blocking Peptide, catalog no. 33R-4840, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 2 antibody


Western Blot analysis using Tropomodulin 2 antibody (70R-5239)

Tropomodulin 2 antibody (70R-5239) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMOD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Tropomodulin 2 antibody (70R-5239) | Tropomodulin 2 antibody (70R-5239) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors