Tropomodulin 2 Blocking Peptide (33R-6513)

A synthetic peptide for use as a blocking control in assays to test for specificity of TMOD2 antibody, catalog no. 70R-5240

Synonyms Tropomodulin 2 control peptide, Tropomodulin 2 antibody Blocking Peptide, Anti-Tropomodulin 2 Blocking Peptide, MGC39481 Blocking Peptide, NTMOD Blocking Peptide, TMOD2 Blocking Peptide, Tropomodulin 2, Tropomodulin -2, Tropomodulin 2, Tropomodulin -2 Blocking Peptide, Tropomodulin 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADI
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors