Tropomodulin 2 Blocking Peptide (33R-6513)
A synthetic peptide for use as a blocking control in assays to test for specificity of TMOD2 antibody, catalog no. 70R-5240
Overview
Overview
| Synonyms | Tropomodulin 2 control peptide, Tropomodulin 2 antibody Blocking Peptide, Anti-Tropomodulin 2 Blocking Peptide, MGC39481 Blocking Peptide, NTMOD Blocking Peptide, TMOD2 Blocking Peptide, Tropomodulin 2, Tropomodulin -2, Tropomodulin 2, Tropomodulin -2 Blocking Peptide, Tropomodulin 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADI |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product