Tropomyosin 2 Blocking Peptide (33R-1152)
A synthetic peptide for use as a blocking control in assays to test for specificity of TPM2 antibody, catalog no. 70R-1264
Overview
Overview
| Synonyms | Tropomyosin 2 control peptide, Tropomyosin 2 antibody Blocking Peptide, Anti-Tropomyosin 2 Blocking Peptide, AMCD1 Blocking Peptide, DA1 Blocking Peptide, TMSB Blocking Peptide, TPM2 Blocking Peptide, Tropomyosin 2, Tropomyosin -2, Tropomyosin 2, Tropomyosin -2 Blocking Peptide, Tropomyosin 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product