Tropomyosin 2 Blocking Peptide (33R-1152)

A synthetic peptide for use as a blocking control in assays to test for specificity of TPM2 antibody, catalog no. 70R-1264

Synonyms Tropomyosin 2 control peptide, Tropomyosin 2 antibody Blocking Peptide, Anti-Tropomyosin 2 Blocking Peptide, AMCD1 Blocking Peptide, DA1 Blocking Peptide, TMSB Blocking Peptide, TPM2 Blocking Peptide, Tropomyosin 2, Tropomyosin -2, Tropomyosin 2, Tropomyosin -2 Blocking Peptide, Tropomyosin 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors