Troponin I Type 2 antibody (70R-1293)

Rabbit polyclonal Troponin I Type 2 antibody

Synonyms Polyclonal Troponin I Type 2 antibody, Anti-Troponin I Type 2 antibody, TNNI2 antibody, FSSV antibody, DA2B antibody, AMCD2B antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen Troponin I Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
Assay Information Troponin I Type 2 Blocking Peptide, catalog no. 33R-7190, is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 2 antibody


Western Blot analysis using Troponin I Type 2 antibody (70R-1293)

Troponin I Type 2 antibody (70R-1293) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TNNI2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Troponin I Type 2 antibody (70R-1293) | Troponin I Type 2 antibody (70R-1293) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors