Troponin T Type 1 Blocking Peptide (33R-9957)
A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT1 antibody, catalog no. 70R-2585
Overview
Overview
| Synonyms | Troponin T Type 1 control peptide, Troponin T Type 1 antibody Blocking Peptide, Anti-Troponin T Type 1 Blocking Peptide, ANM Blocking Peptide, MGC104241 Blocking Peptide, TNNT1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TNNT1 is a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product