Troponin T Type 2 antibody (70R-2008)

Rabbit polyclonal Troponin T Type 2 antibody

Synonyms Polyclonal Troponin T Type 2 antibody, Anti-Troponin T Type 2 antibody, TnTC antibody, TNNT2 antibody, CMPD2 antibody, MGC3889 antibody, cTnT antibody, CMH2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE
Assay Information Troponin T Type 2 Blocking Peptide, catalog no. 33R-2732, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 2 antibody


Western Blot analysis using Troponin T Type 2 antibody (70R-2008)

Troponin T Type 2 antibody (70R-2008) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNNT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNNT2 is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in the gene encoding TNNT2 have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Troponin T Type 2 antibody (70R-2008) | Troponin T Type 2 antibody (70R-2008) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors