Troponin T Type 3 antibody (70R-1233)

Rabbit polyclonal Troponin T Type 3 antibody

Synonyms Polyclonal Troponin T Type 3 antibody, Anti-Troponin T Type 3 antibody, TNNT3 antibody, AMCD2B antibody, DKFZp779M2348 antibody, FSSV antibody, DA2B antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE
Assay Information Troponin T Type 3 Blocking Peptide, catalog no. 33R-7331, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 3 antibody

Images

Western Blot analysis using Troponin T Type 3 antibody (70R-1233)

Troponin T Type 3 antibody (70R-1233) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TNNT3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Troponin T Type 3 antibody (70R-1233) | Troponin T Type 3 antibody (70R-1233) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors