Troponin T Type 3 Blocking Peptide (33R-7331)

A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT3 antibody, catalog no. 70R-1233

Synonyms Troponin T Type 3 control peptide, Troponin T Type 3 antibody Blocking Peptide, Anti-Troponin T Type 3 Blocking Peptide, AMCD2B Blocking Peptide, DA2B Blocking Peptide, DKFZp779M2348 Blocking Peptide, FSSV Blocking Peptide, TNNT3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE
Molecular Weight 30 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors