Troponin T Type 3 Blocking Peptide (33R-7331)
A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT3 antibody, catalog no. 70R-1233
Overview
Overview
| Synonyms | Troponin T Type 3 control peptide, Troponin T Type 3 antibody Blocking Peptide, Anti-Troponin T Type 3 Blocking Peptide, AMCD2B Blocking Peptide, DA2B Blocking Peptide, DKFZp779M2348 Blocking Peptide, FSSV Blocking Peptide, TNNT3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE |
|---|---|
| Molecular Weight | 30 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product