TROVE2 antibody (70R-1372)

Rabbit polyclonal TROVE2 antibody raised against the N terminal of TROVE2

Synonyms Polyclonal TROVE2 antibody, Anti-TROVE2 antibody, Trove Domain Family Member 2 antibody, TROVE 2, TROVE-2 antibody, TROVE-2, TROVE2, TROVE 2 antibody
Specificity TROVE2 antibody was raised against the N terminal of TROVE2
Cross Reactivity Human
Applications IHC, WB
Immunogen TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS
Assay Information TROVE2 Blocking Peptide, catalog no. 33R-7607, is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody


Western Blot analysis using TROVE2 antibody (70R-1372)

TROVE2 antibody (70R-1372) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TROVE2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a RNA-binding protein, TROVE2 binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TROVE2 antibody (70R-1372) | TROVE2 antibody (70R-1372) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors