TRPC4AP antibody (70R-5845)

Rabbit polyclonal TRPC4AP antibody raised against the middle region of TRPC4AP

Synonyms Polyclonal TRPC4AP antibody, Anti-TRPC4AP antibody, TRUSS antibody, TRRP4AP antibody, TRPC-4, Transient Receptor Potential Cation Channel Subfamily C Member 4 Associated Protein antibody, TRPC 4, TRPC 4 antibody, TRPC-4 antibody, C20orf188 antibody, TRPC4
Specificity TRPC4AP antibody was raised against the middle region of TRPC4AP
Cross Reactivity Human
Applications WB
Immunogen TRPC4AP antibody was raised using the middle region of TRPC4AP corresponding to a region with amino acids GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH
Assay Information TRPC4AP Blocking Peptide, catalog no. 33R-3171, is also available for use as a blocking control in assays to test for specificity of this TRPC4AP antibody


Western Blot analysis using TRPC4AP antibody (70R-5845)

TRPC4AP antibody (70R-5845) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPC4AP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPC4AP may participate in the activation of NFKB1 in response to ligation of TNFRSF1A. TRPC4AP could serve as a scaffolding protein to link TNFRSF1A to the IKK signalosome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRPC4AP antibody (70R-5845) | TRPC4AP antibody (70R-5845) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors