TRPC6 antibody (70R-5175)

Rabbit polyclonal TRPC6 antibody raised against the N terminal of TRPC6

Synonyms Polyclonal TRPC6 antibody, Anti-TRPC6 antibody, TRPC 6 antibody, FLJ14863 antibody, FSGS2 antibody, Transient Receptor Potential Cation Channel Subfamily C Member 6 antibody, TRP6 antibody, TRPC-6 antibody, FLJ11098 antibody, TRPC-6, TRPC6, TRPC 6
Specificity TRPC6 antibody was raised against the N terminal of TRPC6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRPC6 antibody was raised using the N terminal of TRPC6 corresponding to a region with amino acids MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC
Assay Information TRPC6 Blocking Peptide, catalog no. 33R-6482, is also available for use as a blocking control in assays to test for specificity of this TRPC6 antibody

Images

Western Blot analysis using TRPC6 antibody (70R-5175)

TRPC6 antibody (70R-5175) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 106 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPC6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRPC6 antibody (70R-5175) | TRPC6 antibody (70R-5175) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors