TRUB2 antibody (70R-4105)

Rabbit polyclonal TRUB2 antibody raised against the N terminal of TRUB2

Synonyms Polyclonal TRUB2 antibody, Anti-TRUB2 antibody, TRUB 2, TRUB-2, TRUB-2 antibody, CLONE24922 antibody, Psi Synthase Homolog 2 antibody, TRUB 2 antibody, Trub Pseudouridine antibody, RP11-339B21.1 antibody, TRUB2
Specificity TRUB2 antibody was raised against the N terminal of TRUB2
Cross Reactivity Human
Applications WB
Immunogen TRUB2 antibody was raised using the N terminal of TRUB2 corresponding to a region with amino acids MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV
Assay Information TRUB2 Blocking Peptide, catalog no. 33R-6072, is also available for use as a blocking control in assays to test for specificity of this TRUB2 antibody

Images

Western Blot analysis using TRUB2 antibody (70R-4105)

TRUB2 antibody (70R-4105) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRUB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRUB2 antibody (70R-4105) | TRUB2 antibody (70R-4105) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors