TSPYL6 Blocking Peptide (33R-6465)
A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL6 antibody, catalog no. 70R-1994
Overview
Overview
| Synonyms | TSPYL6 control peptide, TSPYL6 antibody Blocking Peptide, Anti-TSPYL6 Blocking Peptide, Testis-Specific Y-encoded-like protein 6 Blocking Peptide, Tspy-Like 6 Blocking Peptide, DKFZp434B125 Blocking Peptide, TSPYL6, TSPYL-6, TSPYL 6, TSPYL-6 Blocking Peptide, TSPYL 6 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of TSPYL6 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product