TSPYL6 Blocking Peptide (33R-6465)

A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL6 antibody, catalog no. 70R-1994

Synonyms TSPYL6 control peptide, TSPYL6 antibody Blocking Peptide, Anti-TSPYL6 Blocking Peptide, Testis-Specific Y-encoded-like protein 6 Blocking Peptide, Tspy-Like 6 Blocking Peptide, DKFZp434B125 Blocking Peptide, TSPYL6, TSPYL-6, TSPYL 6, TSPYL-6 Blocking Peptide, TSPYL 6 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TSPYL6 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors