TSR1 antibody (70R-3165)

Rabbit polyclonal TSR1 antibody

Synonyms Polyclonal TSR1 antibody, Anti-TSR1 antibody, KIAA1401 antibody, TSR 1 antibody, Tsr1 20S rRNA Accumulation Homolog antibody, TSR-1, TSR-1 antibody, MGC131829 antibody, TSR1, FLJ10534 antibody, TSR 1
Cross Reactivity Human
Applications WB
Immunogen TSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV
Assay Information TSR1 Blocking Peptide, catalog no. 33R-5698, is also available for use as a blocking control in assays to test for specificity of this TSR1 antibody


Western Blot analysis using TSR1 antibody (70R-3165)

TSR1 antibody (70R-3165) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSR1 belongs to the BMS1/TSR1 family and TSR1 subfamily. TSR1 is required during maturation of the 40S ribosomal subunit in the nucleolus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TSR1 antibody (70R-3165) | TSR1 antibody (70R-3165) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors