TSSK2 antibody (70R-2083)

Rabbit polyclonal TSSK2 antibody raised against the middle region of TSSK2

Synonyms Polyclonal TSSK2 antibody, Anti-TSSK2 antibody, FLJ38613 antibody, TSSK2, TSSK-2 antibody, TSSK 2 antibody, DGS-G antibody, SPOGA2 antibody, TSSK 2, TSSK-2, Testis-Specific Serine Kinase 2 antibody, STK22B antibody
Specificity TSSK2 antibody was raised against the middle region of TSSK2
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD
Assay Information TSSK2 Blocking Peptide, catalog no. 33R-8066, is also available for use as a blocking control in assays to test for specificity of this TSSK2 antibody

Images

Western Blot analysis using TSSK2 antibody (70R-2083)

TSSK2 antibody (70R-2083) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSSK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TSSK2 antibody (70R-2083) | TSSK2 antibody (70R-2083) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors