TTC35 antibody (70R-4420)

Rabbit polyclonal TTC35 antibody raised against the middle region of TTC35

Synonyms Polyclonal TTC35 antibody, Anti-TTC35 antibody, TTC 35, TTC 35 antibody, TTC-35 antibody, TTC35, TTC-35, KIAA0103 antibody, Tetratricopeptide Repeat Domain 35 antibody
Specificity TTC35 antibody was raised against the middle region of TTC35
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TTC35 antibody was raised using the middle region of TTC35 corresponding to a region with amino acids IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE
Assay Information TTC35 Blocking Peptide, catalog no. 33R-4119, is also available for use as a blocking control in assays to test for specificity of this TTC35 antibody


Western Blot analysis using TTC35 antibody (70R-4420)

TTC35 antibody (70R-4420) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTC35 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TTC35 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TTC35 antibody (70R-4420) | TTC35 antibody (70R-4420) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors