TTC9C antibody (70R-3116)

Rabbit polyclonal TTC9C antibody raised against the N terminal of TTC9C

Synonyms Polyclonal TTC9C antibody, Anti-TTC9C antibody, TTCC 9, TTCC 9 antibody, Tetratricopeptide Repeat Domain 9C antibody, TTCC-9 antibody, TTC9C, MGC29649 antibody, TTCC-9
Specificity TTC9C antibody was raised against the N terminal of TTC9C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TTC9C antibody was raised using the N terminal of TTC9C corresponding to a region with amino acids MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLP
Assay Information TTC9C Blocking Peptide, catalog no. 33R-5931, is also available for use as a blocking control in assays to test for specificity of this TTC9C antibody

Images

Western Blot analysis using TTC9C antibody (70R-3116)

TTC9C antibody (70R-3116) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTC9C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TTC9C protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TTC9C antibody (70R-3116) | TTC9C antibody (70R-3116) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors