TUSC1 antibody (70R-2591)

Rabbit polyclonal TUSC1 antibody raised against the middle region of TUSC1

Synonyms Polyclonal TUSC1 antibody, Anti-TUSC1 antibody, TSG9 antibody, MGC131751 antibody, TUSC-1 antibody, TUSC-1, TUSC 1 antibody, TUSC 1, Tumor Suppressor Candidate 1 antibody, TUSC1, TSG-9 antibody
Specificity TUSC1 antibody was raised against the middle region of TUSC1
Cross Reactivity Human,Rat
Applications WB
Immunogen TUSC1 antibody was raised using the middle region of TUSC1 corresponding to a region with amino acids DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL
Assay Information TUSC1 Blocking Peptide, catalog no. 33R-2164, is also available for use as a blocking control in assays to test for specificity of this TUSC1 antibody


Western Blot analysis using TUSC1 antibody (70R-2591)

TUSC1 antibody (70R-2591) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TUSC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TUSC1 antibody (70R-2591) | TUSC1 antibody (70R-2591) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors