TUSC4 Blocking Peptide (33R-8625)

A synthetic peptide for use as a blocking control in assays to test for specificity of TUSC4 antibody, catalog no. 70R-8928

Synonyms TUSC4 control peptide, TUSC4 antibody Blocking Peptide, Anti-TUSC4 Blocking Peptide, tumor suppressor candidate 4 Blocking Peptide, NPR2L Blocking Peptide, NPRL2 Blocking Peptide, TUSC4, TUSC-4, TUSC 4, TUSC-4 Blocking Peptide, TUSC 4 Blocking Peptide, NPR2L, NPR2-like protein Blocking Peptide, NPR2 Blocking Peptide, Nitrogen Permease Regulator-like 2 Blocking Peptide, NPR-2L Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLSPGTTVRDLIGRHPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVTRE
Molecular Weight 44 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TUSC4 suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. TUSC4 down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. TUSC4 may act as a tumor suppressor. TUSC4 suppresses cell growth and enhanced sensitivity to various anticancer drugs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors