TUSC4 Blocking Peptide (33R-8625)
A synthetic peptide for use as a blocking control in assays to test for specificity of TUSC4 antibody, catalog no. 70R-8928
Overview
Overview
| Synonyms | TUSC4 control peptide, TUSC4 antibody Blocking Peptide, Anti-TUSC4 Blocking Peptide, tumor suppressor candidate 4 Blocking Peptide, NPR2L Blocking Peptide, NPRL2 Blocking Peptide, TUSC4, TUSC-4, TUSC 4, TUSC-4 Blocking Peptide, TUSC 4 Blocking Peptide, NPR2L, NPR2-like protein Blocking Peptide, NPR2 Blocking Peptide, Nitrogen Permease Regulator-like 2 Blocking Peptide, NPR-2L Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLSPGTTVRDLIGRHPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVTRE |
|---|---|
| Molecular Weight | 44 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | TUSC4 suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. TUSC4 down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. TUSC4 may act as a tumor suppressor. TUSC4 suppresses cell growth and enhanced sensitivity to various anticancer drugs. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product