TYMS antibody (70R-2717)

Rabbit polyclonal TYMS antibody raised against the C terminal of TYMS

Synonyms Polyclonal TYMS antibody, Anti-TYMS antibody, Thymidylate Synthetase antibody, TS antibody, HsT422 antibody, TSase antibody, MGC88736 antibody, TMS antibody
Specificity TYMS antibody was raised against the C terminal of TYMS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME
Assay Information TYMS Blocking Peptide, catalog no. 33R-3753, is also available for use as a blocking control in assays to test for specificity of this TYMS antibody


Western Blot analysis using TYMS antibody (70R-2717)

TYMS antibody (70R-2717) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TYMS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TYMS antibody (70R-2717) | TYMS antibody (70R-2717) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors