TYR antibody (70R-1886)

Rabbit polyclonal TYR antibody

Synonyms Polyclonal TYR antibody, Anti-TYR antibody, OCAIA antibody, Tyrosinase antibody, OCA1A antibody, Oculocutaneous Albinism Ia antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen TYR antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM
Assay Information TYR Blocking Peptide, catalog no. 33R-1745, is also available for use as a blocking control in assays to test for specificity of this TYR antibody


Western Blot analysis using TYR antibody (70R-1886)

TYR antibody (70R-1886) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TYR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TYR antibody (70R-1886) | TYR antibody (70R-1886) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors