UBE2D2 antibody (70R-1828)

Rabbit polyclonal UBE2D2 antibody

Synonyms Polyclonal UBE2D2 antibody, Anti-UBE2D2 antibody, UBED-2 antibody, UBCH5B antibody, UBED 2 antibody, Ubiquitin-Conjugating Enzyme E2D 2 antibody, UBE2D2, UBED-2, Ubc4/5 Homolog Yeast antibody, PUBC1 antibody, UBED 2, UBC4/5 antibody, E2(17)KB2 antibody, UBC4 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen UBE2D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE
Assay Information UBE2D2 Blocking Peptide, catalog no. 33R-8733, is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody


Immunohistochemical staining using UBE2D2 antibody (70R-1828)

UBE2D2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UBE2D2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using UBE2D2 antibody (70R-1828) | UBE2D2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using UBE2D2 antibody (70R-1828) | UBE2D2 antibody (70R-1828) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors