UBE2I antibody (70R-1159)

Rabbit polyclonal UBE2I antibody

Synonyms Polyclonal UBE2I antibody, Anti-UBE2I antibody, UBEI-2, Ubiquitin-Conjugating Enzyme E2I antibody, UBC9 antibody, UBEI 2 antibody, UBE2I, P18 antibody, UBEI 2, UBEI-2 antibody, C358B7.1 antibody, Ubc9 Homolog Yeast antibody
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen UBE2I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG
Assay Information UBE2I Blocking Peptide, catalog no. 33R-6431, is also available for use as a blocking control in assays to test for specificity of this UBE2I antibody


Western Blot analysis using UBE2I antibody (70R-1159)

UBE2I antibody (70R-1159) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UBE2I antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2I is a member of the E2 ubiquitin-conjugating enzyme family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UBE2I antibody (70R-1159) | UBE2I antibody (70R-1159) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors