UBE2K antibody (70R-2724)

Rabbit polyclonal UBE2K antibody

Synonyms Polyclonal UBE2K antibody, Anti-UBE2K antibody, HYPG antibody, LIG antibody, DKFZp564C1216 antibody, UBEK 2, HIP2 antibody, UBEK-2, UBE2K, UBEK-2 antibody, UBEK 2 antibody, E2-25K antibody, Ubiquitin-Conjugating Enzyme E2K antibody, Ubc1 Homolog Yeast antibody, DKFZp686J24237 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UBE2K antibody was raised using a synthetic peptide corresponding to a region with amino acids QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET
Assay Information UBE2K Blocking Peptide, catalog no. 33R-7744, is also available for use as a blocking control in assays to test for specificity of this UBE2K antibody

Images

Western Blot analysis using UBE2K antibody (70R-2724)

UBE2K antibody (70R-2724) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBE2K antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBE2K belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UBE2K antibody (70R-2724) | UBE2K antibody (70R-2724) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors