UBE2K Blocking Peptide (33R-7744)
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2K antibody, catalog no. 70R-2724
Overview
Overview
| Synonyms | UBE2K control peptide, UBE2K antibody Blocking Peptide, Anti-UBE2K Blocking Peptide, Ubiquitin-Conjugating Enzyme E2K Blocking Peptide, Ubc1 Homolog Yeast Blocking Peptide, DKFZp564C1216 Blocking Peptide, DKFZp686J24237 Blocking Peptide, E2-25K Blocking Peptide, HIP2 Blocking Peptide, HYPG Blocking Peptide, LIG Blocking Peptide, UBE2K, UBEK-2, UBEK 2, UBEK-2 Blocking Peptide, UBEK 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET |
|---|---|
| Molecular Weight | 22 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | UBE2K belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product