UBE2K Blocking Peptide (33R-7744)

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2K antibody, catalog no. 70R-2724

Synonyms UBE2K control peptide, UBE2K antibody Blocking Peptide, Anti-UBE2K Blocking Peptide, Ubiquitin-Conjugating Enzyme E2K Blocking Peptide, Ubc1 Homolog Yeast Blocking Peptide, DKFZp564C1216 Blocking Peptide, DKFZp686J24237 Blocking Peptide, E2-25K Blocking Peptide, HIP2 Blocking Peptide, HYPG Blocking Peptide, LIG Blocking Peptide, UBE2K, UBEK-2, UBEK 2, UBEK-2 Blocking Peptide, UBEK 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET
Molecular Weight 22 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBE2K belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors