UBE2L6 Blocking Peptide (33R-7777)

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2L6 antibody, catalog no. 70R-2779

Synonyms UBE2L6 control peptide, UBE2L6 antibody Blocking Peptide, Anti-UBE2L6 Blocking Peptide, Ubiquitin-Conjugating Enzyme E2L 6 Blocking Peptide, MGC40331 Blocking Peptide, RIG-B Blocking Peptide, UBCH8 Blocking Peptide, UBE2L6, UBEL6-2, UBEL6 2, UBEL6-2 Blocking Peptide, UBEL6 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP
Molecular Weight 18 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L6 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors