UBE2L6 Blocking Peptide (33R-7777)
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2L6 antibody, catalog no. 70R-2779
Overview
Overview
| Synonyms | UBE2L6 control peptide, UBE2L6 antibody Blocking Peptide, Anti-UBE2L6 Blocking Peptide, Ubiquitin-Conjugating Enzyme E2L 6 Blocking Peptide, MGC40331 Blocking Peptide, RIG-B Blocking Peptide, UBCH8 Blocking Peptide, UBE2L6, UBEL6-2, UBEL6 2, UBEL6-2 Blocking Peptide, UBEL6 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP |
|---|---|
| Molecular Weight | 18 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L6 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product