UBE2N antibody (70R-1157)

Rabbit polyclonal UBE2N antibody

Synonyms Polyclonal UBE2N antibody, Anti-UBE2N antibody, Ubc13 Homolog Yeast antibody, UBEN 2, UBEN 2 antibody, UBEN-2 antibody, UBE2N, UBEN-2, Ubiquitin-Conjugating Enzyme E2N antibody
Cross Reactivity Human,Mouse,Rat,Dog,Drosophila,ZebraFish
Applications WB
Immunogen UBE2N antibody was raised using a synthetic peptide corresponding to a region with amino acids VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW
Assay Information UBE2N Blocking Peptide, catalog no. 33R-9466, is also available for use as a blocking control in assays to test for specificity of this UBE2N antibody

Images

Western Blot analysis using UBE2N antibody (70R-1157)

UBE2N antibody (70R-1157) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UBE2N antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UBE2N antibody (70R-1157) | UBE2N antibody (70R-1157) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors