UBE2V1 Blocking Peptide (33R-10335)

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2V1 antibody, catalog no. 70R-10359

Synonyms UBE2V1 control peptide, UBE2V1 antibody Blocking Peptide, Anti-UBE2V1 Blocking Peptide, ubiquitin-conjugating enzyme E2 variant 1 Blocking Peptide, CIR1 Blocking Peptide, CROC-1 Blocking Peptide, CROC1 Blocking Peptide, UBE2V Blocking Peptide, UEV-1 Blocking Peptide, UEV1 Blocking Peptide, UEV1A Blocking Peptide, UBE2V1, UBEV1-2, UBEV1 2, UBEV1-2 Blocking Peptide, UBEV1 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
Molecular Weight 16 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Multiple alternatively spliced transcripts encoding different isoforms have been described for this gene. A pseudogene has been identified which is also located on chromosome 20. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors