UBE3A antibody (70R-5247)

Rabbit polyclonal UBE3A antibody raised against the middle region of Ube3A

Synonyms Polyclonal UBE3A antibody, Anti-UBE3A antibody, UBEA-3 antibody, HPVE6A antibody, UBEA 3 antibody, FLJ26981 antibody, Ubiquitin-Conjugating Enzyme E3A antibody, UBEA-3, UBE3A, UBEA 3, EPVE6AP antibody, ANCR antibody, E6-AP antibody, AS antibody
Specificity UBE3A antibody was raised against the middle region of Ube3A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UBE3A antibody was raised using the middle region of Ube3A corresponding to a region with amino acids AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
Assay Information UBE3A Blocking Peptide, catalog no. 33R-1304, is also available for use as a blocking control in assays to test for specificity of this UBE3A antibody

Images

Western Blot analysis using UBE3A antibody (70R-5247)

UBE3A antibody (70R-5247) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 101 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBE3A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBE3A is an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UBE3A antibody (70R-5247) | UBE3A antibody (70R-5247) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
OR
Shipping
View Our Distributors