UBE4A Blocking Peptide (33R-7789)
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE4A antibody, catalog no. 70R-2780
Overview
Overview
| Synonyms | UBE4A control peptide, UBE4A antibody Blocking Peptide, Anti-UBE4A Blocking Peptide, Ubiquitination Factor E4A Blocking Peptide, Ufd2 Homolog Yeast Blocking Peptide, E4 Blocking Peptide, KIAA0126 Blocking Peptide, MGC133315 Blocking Peptide, UBOX2 Blocking Peptide, UFD2 Blocking Peptide, UBE4A, UBEA-4, UBEA 4, UBEA-4 Blocking Peptide, UBEA 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR |
|---|---|
| Molecular Weight | 123 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product