UBE4A Blocking Peptide (33R-7789)

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE4A antibody, catalog no. 70R-2780

Synonyms UBE4A control peptide, UBE4A antibody Blocking Peptide, Anti-UBE4A Blocking Peptide, Ubiquitination Factor E4A Blocking Peptide, Ufd2 Homolog Yeast Blocking Peptide, E4 Blocking Peptide, KIAA0126 Blocking Peptide, MGC133315 Blocking Peptide, UBOX2 Blocking Peptide, UFD2 Blocking Peptide, UBE4A, UBEA-4, UBEA 4, UBEA-4 Blocking Peptide, UBEA 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR
Molecular Weight 123 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors