UBE4B antibody (70R-2330)

Rabbit polyclonal UBE4B antibody

Synonyms Polyclonal UBE4B antibody, Anti-UBE4B antibody, UFD2 antibody, E4 antibody, Ubiquitination Factor E4B antibody, UBEB 4 antibody, Ufd2 Homolog Yeast antibody, UBEB-4 antibody, KIAA0684 antibody, UBE4B, UBEB-4, HDNB1 antibody, UBOX3 antibody, UBEB 4
Cross Reactivity Human
Applications WB
Immunogen UBE4B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL
Assay Information UBE4B Blocking Peptide, catalog no. 33R-8685, is also available for use as a blocking control in assays to test for specificity of this UBE4B antibody

Western Blot analysis using UBE4B antibody (70R-2330)

UBE4B antibody (70R-2330) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 146 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBE4B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using UBE4B antibody (70R-2330) | UBE4B antibody (70R-2330) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors