UBE4B Blocking Peptide (33R-8685)
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE4B antibody, catalog no. 70R-2330
Overview
Overview
| Synonyms | UBE4B control peptide, UBE4B antibody Blocking Peptide, Anti-UBE4B Blocking Peptide, Ubiquitination Factor E4B Blocking Peptide, Ufd2 Homolog Yeast Blocking Peptide, E4 Blocking Peptide, HDNB1 Blocking Peptide, KIAA0684 Blocking Peptide, UBOX3 Blocking Peptide, UFD2 Blocking Peptide, UBE4B, UBEB-4, UBEB 4, UBEB-4 Blocking Peptide, UBEB 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL |
|---|---|
| Molecular Weight | 146 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product