UBR1 antibody (70R-2637)

Rabbit polyclonal UBR1 antibody raised against the N terminal of UBR1

Synonyms Polyclonal UBR1 antibody, Anti-UBR1 antibody, UBR-1 antibody, UBR1, UBR 1 antibody, UBR-1, JBS antibody, MGC142065 antibody, MGC142067 antibody, Ubiquitin Protein Ligase E3 Component N-Recognin 1 antibody, UBR 1
Specificity UBR1 antibody was raised against the N terminal of UBR1
Cross Reactivity Human
Applications WB
Immunogen UBR1 antibody was raised using the N terminal of UBR1 corresponding to a region with amino acids YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL
Assay Information UBR1 Blocking Peptide, catalog no. 33R-10155, is also available for use as a blocking control in assays to test for specificity of this UBR1 antibody


Western Blot analysis using UBR1 antibody (70R-2637)

UBR1 antibody (70R-2637) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 200 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBR1 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. recognises and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using UBR1 antibody (70R-2637) | UBR1 antibody (70R-2637) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors