UBR2 antibody (70R-2651)

Rabbit polyclonal UBR2 antibody raised against the C terminal of UBR2

Synonyms Polyclonal UBR2 antibody, Anti-UBR2 antibody, RP3-392M17.3 antibody, UBR-2 antibody, DKFZp686C08114 antibody, UBR 2, Ubiquitin Protein Ligase E3 Component N-Recognin 2 antibody, dJ242G1.1 antibody, UBR2, UBR-2, C6orf133 antibody, UBR 2 antibody, bA49A4.1 antibody, KIAA0349 antibody, dJ392M17.3 antibody, MGC71112 antibody
Specificity UBR2 antibody was raised against the C terminal of UBR2
Cross Reactivity Human
Applications WB
Immunogen UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL
Assay Information UBR2 Blocking Peptide, catalog no. 33R-7566, is also available for use as a blocking control in assays to test for specificity of this UBR2 antibody

Western Blot analysis using UBR2 antibody (70R-2651)

UBR2 antibody (70R-2651) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 200 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognise the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using UBR2 antibody (70R-2651) | UBR2 antibody (70R-2651) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors