UCHL3 antibody (70R-3126)

Rabbit polyclonal UCHL3 antibody

Synonyms Polyclonal UCHL3 antibody, Anti-UCHL3 antibody, UCHL-3 antibody, UCHL-3, Ubiquitin Thiolesterase antibody, UCHL3, UCHL 3 antibody, UCHL 3, Ubiquitin Carboxyl-Terminal Esterase L3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UCHL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC
Assay Information UCHL3 Blocking Peptide, catalog no. 33R-5920, is also available for use as a blocking control in assays to test for specificity of this UCHL3 antibody


Immunohistochemical staining using UCHL3 antibody (70R-3126)

UCHL3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UCHL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognises and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using UCHL3 antibody (70R-3126) | UCHL3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using UCHL3 antibody (70R-3126) | UCHL3 antibody (70R-3126) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors