UCK1 Blocking Peptide (33R-7716)

A synthetic peptide for use as a blocking control in assays to test for specificity of UCK1 antibody, catalog no. 70R-10374

Synonyms UCK1 control peptide, UCK1 antibody Blocking Peptide, Anti-UCK1 Blocking Peptide, uridine-cytidine kinase 1 Blocking Peptide, FLJ12255 Blocking Peptide, URK1 Blocking Peptide, UCK1, UCK-1, UCK 1, UCK-1 Blocking Peptide, UCK 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV
Molecular Weight 30 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Uridine/cytidine kinase-1 is a pyrimidine ribonucleoside kinase that catalyzes the phosphorylation of uridine and cytidine to form uridine monophosphate (UMP) and cytidine monophosphate (CMP).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors