UCK1 Blocking Peptide (33R-7716)
A synthetic peptide for use as a blocking control in assays to test for specificity of UCK1 antibody, catalog no. 70R-10374
Overview
Overview
| Synonyms | UCK1 control peptide, UCK1 antibody Blocking Peptide, Anti-UCK1 Blocking Peptide, uridine-cytidine kinase 1 Blocking Peptide, FLJ12255 Blocking Peptide, URK1 Blocking Peptide, UCK1, UCK-1, UCK 1, UCK-1 Blocking Peptide, UCK 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV |
|---|---|
| Molecular Weight | 30 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Uridine/cytidine kinase-1 is a pyrimidine ribonucleoside kinase that catalyzes the phosphorylation of uridine and cytidine to form uridine monophosphate (UMP) and cytidine monophosphate (CMP). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product