UCK2 antibody (70R-3434)

Rabbit polyclonal UCK2 antibody raised against the N terminal of UCK2

Synonyms Polyclonal UCK2 antibody, Anti-UCK2 antibody, UCK 2 antibody, Uridine-Cytidine Kinase 2 antibody, UK antibody, UCK-2, UMPK antibody, TSA903 antibody, UCK-2 antibody, UCK 2, UCK2
Specificity UCK2 antibody was raised against the N terminal of UCK2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen UCK2 antibody was raised using the N terminal of UCK2 corresponding to a region with amino acids AGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDY
Assay Information UCK2 Blocking Peptide, catalog no. 33R-1189, is also available for use as a blocking control in assays to test for specificity of this UCK2 antibody

Images

Western Blot analysis using UCK2 antibody (70R-3434)

UCK2 antibody (70R-3434) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UCK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UCK2 catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UCK2 antibody (70R-3434) | UCK2 antibody (70R-3434) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors