UGCGL1 Blocking Peptide (33R-1061)
A synthetic peptide for use as a blocking control in assays to test for specificity of UGCGL1 antibody, catalog no. 70R-4490
Overview
Overview
| Synonyms | UGCGL1 control peptide, UGCGL1 antibody Blocking Peptide, Anti-UGCGL1 Blocking Peptide, Udp-Glucose Glycoprotein Glucosyltransferase 1 Blocking Peptide, FLJ23671 Blocking Peptide, FLJ23796 Blocking Peptide, HUGT1 Blocking Peptide, UGCGL1, UGCGL-1, UGCGL 1, UGCGL-1 Blocking Peptide, UGCGL 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE |
|---|---|
| Molecular Weight | 175 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product