UGCGL1 Blocking Peptide (33R-1061)

A synthetic peptide for use as a blocking control in assays to test for specificity of UGCGL1 antibody, catalog no. 70R-4490

Synonyms UGCGL1 control peptide, UGCGL1 antibody Blocking Peptide, Anti-UGCGL1 Blocking Peptide, Udp-Glucose Glycoprotein Glucosyltransferase 1 Blocking Peptide, FLJ23671 Blocking Peptide, FLJ23796 Blocking Peptide, HUGT1 Blocking Peptide, UGCGL1, UGCGL-1, UGCGL 1, UGCGL-1 Blocking Peptide, UGCGL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE
Molecular Weight 175 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors