UGT1A9 antibody (70R-7516)

Rabbit polyclonal UGT1A9 antibody raised against the N terminal of UGT1A9

Synonyms Polyclonal UGT1A9 antibody, Anti-UGT1A9 antibody, UGT1A9, HLUGP4 antibody, UGT1AI antibody, UGTA9 1 antibody, UGTA9 1, UGTA9-1 antibody, Udp Glucuronosyltransferase 1 Family Polypeptide A9 antibody, UGTA9-1, LUGP4 antibody, UDPGT antibody
Specificity UGT1A9 antibody was raised against the N terminal of UGT1A9
Cross Reactivity Human,Rat
Applications WB
Immunogen UGT1A9 antibody was raised using the N terminal of UGT1A9 corresponding to a region with amino acids LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV
Assay Information UGT1A9 Blocking Peptide, catalog no. 33R-5168, is also available for use as a blocking control in assays to test for specificity of this UGT1A9 antibody

Images

Western Blot analysis using UGT1A9 antibody (70R-7516)

UGT1A9 antibody (70R-7516) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UGT1A9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UGT1A9 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. UGT1A9 is active on phenols.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UGT1A9 antibody (70R-7516) | UGT1A9 antibody (70R-7516) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors