Uhmk1 Blocking Peptide (33R-10312)

A synthetic peptide for use as a blocking control in assays to test for specificity of Uhmk1 antibody, catalog no. 70R-8494

Synonyms Uhmk1 control peptide, Uhmk1 antibody Blocking Peptide, Anti-Uhmk1 Blocking Peptide, U2AF homology motif, UHM kinase 1 Blocking Peptide, 4732477C12Rik Blocking Peptide, 4930500M09Rik Blocking Peptide, AA673513 Blocking Peptide, AI449218 Blocking Peptide, AU021979 Blocking Peptide, KIS Blocking Peptide, Kist Blocking Peptide, Uhmk1, Uhmk-1, Uhmk 1, Uhmk-1 Blocking Peptide, Uhmk 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues DDDYLENEDEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANA
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Upon serum stimulation,Uhmk1 phosphorylates CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cell cycle progression in G1 phase. It may be involved in trafficking and/or processing of RNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors