UNC45A Blocking Peptide (33R-7872)

A synthetic peptide for use as a blocking control in assays to test for specificity of UNC45A antibody, catalog no. 70R-2703

Synonyms UNC45A control peptide, UNC45A antibody Blocking Peptide, Anti-UNC45A Blocking Peptide, Unc-45 Homolog A Blocking Peptide, FLJ10043 Blocking Peptide, GC-UNC45 Blocking Peptide, IRO039700 Blocking Peptide, SMAP-1 Blocking Peptide, UNC45A, UNCA-45, UNCA 45, UNCA-45 Blocking Peptide, UNCA 45 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
Molecular Weight 102 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors