UNC45A Blocking Peptide (33R-7872)
A synthetic peptide for use as a blocking control in assays to test for specificity of UNC45A antibody, catalog no. 70R-2703
Overview
Overview
| Synonyms | UNC45A control peptide, UNC45A antibody Blocking Peptide, Anti-UNC45A Blocking Peptide, Unc-45 Homolog A Blocking Peptide, FLJ10043 Blocking Peptide, GC-UNC45 Blocking Peptide, IRO039700 Blocking Peptide, SMAP-1 Blocking Peptide, UNC45A, UNCA-45, UNCA 45, UNCA-45 Blocking Peptide, UNCA 45 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG |
|---|---|
| Molecular Weight | 102 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product