UPB1 antibody (70R-1078)

Rabbit polyclonal UPB1 antibody raised against the middle region of UPB1

Synonyms Polyclonal UPB1 antibody, Anti-UPB1 antibody, UPB 1 antibody, UPB-1 antibody, UPB1, Ureidopropionase Beta antibody, UPB 1, BUP1 antibody, UPB-1
Specificity UPB1 antibody was raised against the middle region of UPB1
Cross Reactivity Human,Mouse,Rat,Dog,Arabidopsis,C.elegans,Drosophila,ZebraFish
Applications WB
Immunogen UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV
Assay Information UPB1 Blocking Peptide, catalog no. 33R-1619, is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody

Images

Western Blot analysis using UPB1 antibody (70R-1078)

UPB1 antibody (70R-1078) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UPB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UPB1 antibody (70R-1078) | UPB1 antibody (70R-1078) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors